Lineage for d3nw7a_ (3nw7 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220897Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1220898Species Human (Homo sapiens) [TaxId:9606] [69826] (15 PDB entries)
  8. 1220905Domain d3nw7a_: 3nw7 A: [182591]
    automated match to d1m7na_
    complexed with lgv

Details for d3nw7a_

PDB Entry: 3nw7 (more details), 2.11 Å

PDB Description: Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (34)
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3nw7a_:

Sequence, based on SEQRES records: (download)

>d3nw7a_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
yvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerie
flneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlap
pslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyy
rkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvm
egglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

Sequence, based on observed residues (ATOM records): (download)

>d3nw7a_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
yvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerie
flneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlap
pslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyy
rkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegg
lldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

SCOPe Domain Coordinates for d3nw7a_:

Click to download the PDB-style file with coordinates for d3nw7a_.
(The format of our PDB-style files is described here.)

Timeline for d3nw7a_: