Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries) |
Domain d3nv2a_: 3nv2 A: [182574] automated match to d1a3ka_ complexed with ni |
PDB Entry: 3nv2 (more details), 2.34 Å
SCOPe Domain Sequences for d3nv2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nv2a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpaypmpfittilgglypsksillsgtvlpsaqrfhinlcsgnhiafhlnprfdenavvr ntqidnswgseerslprkmpfvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlpti nrlevggdiqlthvqt
Timeline for d3nv2a_: