SCOPe 2.06: Domain d3nu6b_: 3nu6 B:

Lineage for d3nu6b_ (3nu6 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3nu6b_: 3nu6 B: [182551]
   automated match to d1dw6c_
   complexed with 478, act, cl, na; mutant

Details for d3nu6b_

PDB Entry: 3nu6, 1.16 Å

PDB Description: Crystal Structure of HIV-1 Protease Mutant I54M with Antiviral Drug Amprenavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3nu6b_:

Sequence; same for both SEQRES and ATOM records:

>d3nu6b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3nu6b_:

• d3nu6b_ first appeared in SCOPe 2.01
  
• d3nu6b_ appears in SCOPe 2.05
  
• d3nu6b_ appears in SCOPe 2.07
  
• d3nu6b_ appears in the current release, SCOPe 2.08