Lineage for d3nspa_ (3nsp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729484Domain d3nspa_: 3nsp A: [182522]
    automated match to d1lbda_

Details for d3nspa_

PDB Entry: 3nsp (more details), 2.9 Å

PDB Description: Crystal structure of tetrameric RXRalpha-LBD
PDB Compounds: (A:) Retinoid X receptor, alpha

SCOPe Domain Sequences for d3nspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nspa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkli
gdtpidtflmeml

SCOPe Domain Coordinates for d3nspa_:

Click to download the PDB-style file with coordinates for d3nspa_.
(The format of our PDB-style files is described here.)

Timeline for d3nspa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3nspb_