Lineage for d1qf1a1 (1qf1 A:156-316)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.67: Thermolysin-like metalloproteases, C-terminal domain [47900] (1 superfamily) Superfamily a.67.1: Thermolysin-like metalloproteases, C-terminal domain [47901] (1 family) 
Family a.67.1.1: Thermolysin-like metalloproteases, C-terminal domain [47902] (4 proteins) 
Protein Thermolysin [47905] (1 species) Species Bacillus thermoproteolyticus [TaxId:1427] [47906] (33 PDB entries) 
Domain d1qf1a1: 1qf1 A:156-316 [18252]
Other proteins in same PDB: d1qf1a2
Details for d1qf1a1
PDB Entry: 1qf1 (more details), 2 Å
PDB Description: thermolysin (e.c.3.4.24.27) complexed with (2-sulphanylheptanoyl)-phe- ala. parameters for zn-bidentation of mercaptoacyldipeptides in metalloendopeptidase
SCOP Domain Sequences for d1qf1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qf1a1 a.67.1.1 (A:156-316) Thermolysin {Bacillus thermoproteolyticus}
iyqnesgaineaisdifgtlvefyanknpdweigedvytpgisgdslrsmsdpakygdpd
hyskrytgtqdnggvhinsgiinkaaylisqggthygvsvvgigrdklgkifyraltqyl
tptsnfsqlraaavqsatdlygstsqevasvkqafdavgvk
SCOP Domain Coordinates for d1qf1a1:
Click to download the PDB-style file with coordinates for d1qf1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qf1a1:
- d1qf1a1 does not appear in SCOP 1.57
View in 3D
