SCOPe 2.08: Domain d3npcb_: 3npc B:

Lineage for d3npcb_ (3npc B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d3npcb_: 3npc B: [182462]
   automated match to d1jnka_
   complexed with b96

Details for d3npcb_

PDB Entry: 3npc, 2.35 Å

PDB Description: Crystal structure of JNK2 complexed with BIRB796

PDB Compounds: (B:) Mitogen-activated protein kinase 9

SCOPe Domain Sequences for d3npcb_:

Sequence; same for both SEQRES and ATOM records:

>d3npcb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfqnqtha
krayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihmeldher
msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartactnfmmtpyvv
tryyrapevilgmgyaanvdiwsvgcimgelvkgcvifqgtdhidqwnkvieqlgtpsae
fmaalqptvrnyvenrpkypgikfeelfpdwifpseserdkiktsqardllskmlvidpd
krisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykevmdw

Timeline for d3npcb_:

• d3npcb_ first appeared in SCOPe 2.01
  
• d3npcb_ appears in SCOPe 2.07