Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries) |
Domain d3npca_: 3npc A: [182461] automated match to d1jnka_ complexed with b96 |
PDB Entry: 3npc (more details), 2.35 Å
SCOPe Domain Sequences for d3npca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3npca_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dnqfysvevadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfqnqth akrayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihmeldhe rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartactnfmmtpyv vtryyrapevilgmgyaanvdiwsvgcimgelvkgcvifqgtdhidqwnkvieqlgtpsa efmaalqptvrnyvenrpkypgikfeelfpdwifpseserdkiktsqardllskmlvidp dkrisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykevmdw
Timeline for d3npca_: