SCOPe 2.01: Domain d3np2x_: 3np2 X:

Lineage for d3np2x_ (3np2 X:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (18 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)

8. Domain d3np2x_: 3np2 X: [182454]
   automated match to d1hrsa_
   complexed with cd, edo, pd, pll, so4

Details for d3np2x_

PDB Entry: 3np2, 1.86 Å

PDB Description: Crystal Structure of Pd(allyl)/apo-E45C/C48A-rHLFr

PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d3np2x_:

Sequence; same for both SEQRES and ATOM records:

>d3np2x_ a.25.1.1 (X:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvahffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh

Timeline for d3np2x_:

• d3np2x_ is new in SCOPe 2.01-stable
  
• d3np2x_ appears in SCOPe 2.02
  
• d3np2x_ appears in the current release, SCOPe 2.08