Lineage for d3nmuj_ (3nmu J:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378546Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
    automatically mapped to Pfam PF01269
  6. 1378547Protein Fibrillarin homologue [53343] (4 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [224904] (3 PDB entries)
  8. 1378558Domain d3nmuj_: 3nmu J: [182414]
    automated match to d1prya_
    protein/RNA complex; complexed with sam

Details for d3nmuj_

PDB Entry: 3nmu (more details), 2.73 Å

PDB Description: Crystal Structure of substrate-bound halfmer box C/D RNP
PDB Compounds: (J:) Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase

SCOPe Domain Sequences for d3nmuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nmuj_ c.66.1.3 (J:) Fibrillarin homologue {Pyrococcus furiosus [TaxId: 2261]}
mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklga
aivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpivee
rrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavks
rsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp

SCOPe Domain Coordinates for d3nmuj_:

Click to download the PDB-style file with coordinates for d3nmuj_.
(The format of our PDB-style files is described here.)

Timeline for d3nmuj_: