SCOPe 2.05: Domain d3nm5b_: 3nm5 B:

Lineage for d3nm5b_ (3nm5 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [189517] (11 PDB entries)

8. Domain d3nm5b_: 3nm5 B: [182388]
   automated match to d1jysa_
   complexed with fmc

Details for d3nm5b_

PDB Entry: 3nm5, 1.8 Å

PDB Description: Helicobacter pylori MTAN complexed with Formycin A

PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d3nm5b_:

Sequence; same for both SEQRES and ATOM records:

>d3nm5b_ c.56.2.0 (B:) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

Timeline for d3nm5b_:

• d3nm5b_ first appeared in SCOPe 2.01
  
• d3nm5b_ appears in SCOPe 2.04
  
• d3nm5b_ appears in SCOPe 2.06
  
• d3nm5b_ appears in the current release, SCOPe 2.08