Lineage for d1lnfe1 (1lnf E:156-316)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.67: Thermolysin-like metalloproteases, C-terminal domain [47900] (1 superfamily) Superfamily a.67.1: Thermolysin-like metalloproteases, C-terminal domain [47901] (1 family) 
Family a.67.1.1: Thermolysin-like metalloproteases, C-terminal domain [47902] (4 proteins) 
Protein Thermolysin [47905] (1 species) Species Bacillus thermoproteolyticus [TaxId:1427] [47906] (33 PDB entries) 
Domain d1lnfe1: 1lnf E:156-316 [18237]
Other proteins in same PDB: d1lnfe2
Details for d1lnfe1
PDB Entry: 1lnf (more details), 1.7 Å
PDB Description: a structural analysis of metal substitutions in thermolysin
SCOP Domain Sequences for d1lnfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnfe1 a.67.1.1 (E:156-316) Thermolysin {Bacillus thermoproteolyticus}
iyqnesgaineaisdifgtlvefyanknpdweigedvytpgisgdslrsmsdpakygdpd
hyskrytgtqdnggvhinsgiinkaaylisqggthygvsvvgigrdklgkifyraltqyl
tptsnfsqlraaavqsatdlygstsqevasvkqafdavgvk
SCOP Domain Coordinates for d1lnfe1:
Click to download the PDB-style file with coordinates for d1lnfe1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lnfe1:
- d1lnfe1 does not appear in SCOP 1.57
View in 3D
