Lineage for d2tlxa1 (2tlx A:156-316)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4694Fold a.67: Thermolysin-like metalloproteases, C-terminal domain [47900] (1 superfamily)
  4. 4695Superfamily a.67.1: Thermolysin-like metalloproteases, C-terminal domain [47901] (1 family) (S)
  5. 4696Family a.67.1.1: Thermolysin-like metalloproteases, C-terminal domain [47902] (4 proteins)
  6. 4707Protein Thermolysin [47905] (1 species)
  7. 4708Species Bacillus thermoproteolyticus [TaxId:1427] [47906] (33 PDB entries)
  8. 4710Domain d2tlxa1: 2tlx A:156-316 [18232]
    Other proteins in same PDB: d2tlxa2

Details for d2tlxa1

PDB Entry: 2tlx (more details), 1.65 Å

PDB Description: thermolysin (native)

SCOP Domain Sequences for d2tlxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tlxa1 a.67.1.1 (A:156-316) Thermolysin {Bacillus thermoproteolyticus}
iyqnesgaineaisdifgtlvefyanknpdweigedvytpgisgdslrsmsdpakygdpd
hyskrytgtqdnggvhinsgiinkaaylisqggthygvsvvgigrdklgkifyraltqyl
tptsnfsqlraaavqsatdlygstsqevasvkqafdavgvk

SCOP Domain Coordinates for d2tlxa1:

Click to download the PDB-style file with coordinates for d2tlxa1.
(The format of our PDB-style files is described here.)

Timeline for d2tlxa1:

  • d2tlxa1 does not appear in SCOP 1.57

View in 3D
Domains from same chain:
(mouse over for more information)
d2tlxa2