Lineage for d3nifa_ (3nif A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809519Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2809520Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2809521Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2809522Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (27 PDB entries)
    Uniprot P08514 32-483
  8. 2809530Domain d3nifa_: 3nif A: [182318]
    Other proteins in same PDB: d3nife_, d3niff1, d3niff2, d3nifh_, d3nifl1, d3nifl2
    automated match to d1tyea_
    complexed with ca, gol, mg, nag, nif, so4

Details for d3nifa_

PDB Entry: 3nif (more details), 2.4 Å

PDB Description: the closed headpiece of integrin iib 3 and its complex with an iib 3 - specific antagonist that does not induce opening
PDB Compounds: (A:) Integrin alphaIIB beta3

SCOPe Domain Sequences for d3nifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nifa_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvv

SCOPe Domain Coordinates for d3nifa_:

Click to download the PDB-style file with coordinates for d3nifa_.
(The format of our PDB-style files is described here.)

Timeline for d3nifa_: