![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
![]() | Protein automated matches [191167] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189384] (6 PDB entries) |
![]() | Domain d3nhea_: 3nhe A: [182287] Other proteins in same PDB: d3nheb_ automated match to d2ibia1 complexed with zn |
PDB Entry: 3nhe (more details), 1.26 Å
SCOPe Domain Sequences for d3nhea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nhea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls lpiakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhl krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc rspgtgewhtfndssvtpmsssqvrtsdayllfyelas
Timeline for d3nhea_: