SCOPe 2.05: Domain d3ng6b_: 3ng6 B:

Lineage for d3ng6b_ (3ng6 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (6 PDB entries)

8. Domain d3ng6b_: 3ng6 B: [182255]
   Other proteins in same PDB: d3ng6a_, d3ng6c_
   automated match to d1t1nb_
   complexed with hem

Details for d3ng6b_

PDB Entry: 3ng6, 2.2 Å

PDB Description: The crystal structure of hemoglobin I from Trematomus newnesi in deoxygenated state obtained through an oxidation/reduction cycle in which potassium hexacyanoferrate and sodium dithionite were alternatively added

PDB Compounds: (B:) Hemoglobin subunit beta-1/2

SCOPe Domain Sequences for d3ng6b_:

Sequence; same for both SEQRES and ATOM records:

>d3ng6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh

Timeline for d3ng6b_:

• d3ng6b_ first appeared in SCOPe 2.01
  
• d3ng6b_ appears in SCOPe 2.04
  
• d3ng6b_ appears in SCOPe 2.06
  
• d3ng6b_ appears in the current release, SCOPe 2.08