SCOP 1.71: Domain d1gp2a1: 1gp2 A:61-181

Lineage for d1gp2a1 (1gp2 A:61-181)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)

8. Domain d1gp2a1: 1gp2 A:61-181 [18225]
   Other proteins in same PDB: d1gp2a2, d1gp2b_, d1gp2g_
   complexed with gdp; mutant

Details for d1gp2a1

PDB Entry: 1gp2, 2.3 Å

PDB Description: g protein heterotrimer gi_alpha_1 beta_1 gamma_2 with gdp bound

SCOP Domain Sequences for d1gp2a1:

Sequence; same for both SEQRES and ATOM records:

>d1gp2a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1gp2a1:

• d1gp2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1gp2a1 appears in SCOP 1.69
  
• d1gp2a1 appears in SCOP 1.73
  
• d1gp2a1 appears in the current release, SCOPe 2.08