Class a: All alpha proteins [46456] (226 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries) |
Domain d1fqkc1: 1fqk C:61-181 [18221] Other proteins in same PDB: d1fqka2, d1fqkb_, d1fqkc2, d1fqkd_ species chimera complexed with alf, gdp, mg |
PDB Entry: 1fqk (more details), 2.3 Å
SCOP Domain Sequences for d1fqkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqkc1 a.66.1.1 (C:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)} eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi i
Timeline for d1fqkc1:
View in 3D Domains from other chains: (mouse over for more information) d1fqka1, d1fqka2, d1fqkb_, d1fqkd_ |