SCOP 1.71: Domain d1fqkc1: 1fqk C:61-181

Lineage for d1fqkc1 (1fqk C:61-181)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)

8. Domain d1fqkc1: 1fqk C:61-181 [18221]
   Other proteins in same PDB: d1fqka2, d1fqkb_, d1fqkc2, d1fqkd_
   species chimera
   complexed with alf, gdp, mg

Details for d1fqkc1

PDB Entry: 1fqk, 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqkc1:

Sequence; same for both SEQRES and ATOM records:

>d1fqkc1 a.66.1.1 (C:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

Timeline for d1fqkc1:

• d1fqkc1 first appeared (with stable ids) in SCOP 1.55
  
• d1fqkc1 appears in SCOP 1.69
  
• d1fqkc1 appears in SCOP 1.73
  
• d1fqkc1 appears in the current release, SCOPe 2.08