SCOPe 2.04: Domain d3neyb_: 3ney B:

Lineage for d3neyb_ (3ney B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)

8. Domain d3neyb_: 3ney B: [182207]
   automated match to d1kgda_
   complexed with so4, unx

Details for d3neyb_

PDB Entry: 3ney, 2.26 Å

PDB Description: crystal structure of the kinase domain of mpp1/p55

PDB Compounds: (B:) 55 kDa erythrocyte membrane protein

SCOPe Domain Sequences for d3neyb_:

Sequence; same for both SEQRES and ATOM records:

>d3neyb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfistee
mtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfiv
fiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq

Timeline for d3neyb_:

• d3neyb_ first appeared in SCOPe 2.01
  
• d3neyb_ appears in SCOPe 2.03
  
• d3neyb_ appears in SCOPe 2.05
  
• d3neyb_ appears in the current release, SCOPe 2.08, called d3neyb1