SCOPe 2.03: Domain d1fqka1: 1fqk A:61-181

Lineage for d1fqka1 (1fqk A:61-181)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)

8. Domain d1fqka1: 1fqk A:61-181 [18220]
   Other proteins in same PDB: d1fqka2, d1fqkb_, d1fqkc2, d1fqkd_
   species chimera
   complexed with alf, gdp, mg

Details for d1fqka1

PDB Entry: 1fqk, 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

PDB Compounds: (A:) chimera of guanine nucleotide-binding protein g(t), alpha-1 subunit and guanine nucleotide-binding protein g(I), alpha-1 subunit

SCOPe Domain Sequences for d1fqka1:

Sequence; same for both SEQRES and ATOM records:

>d1fqka1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

Timeline for d1fqka1:

• d1fqka1 first appeared (with stable ids) in SCOP 1.55
  
• d1fqka1 appears in SCOPe 2.02
  
• d1fqka1 appears in SCOPe 2.04
  
• d1fqka1 appears in the current release, SCOPe 2.08