Lineage for d3ndra_ (3ndr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580981Species Mesorhizobium loti [TaxId:381] [189923] (3 PDB entries)
  8. 1580990Domain d3ndra_: 3ndr A: [182174]
    automated match to d2ew8a1
    complexed with nad

Details for d3ndra_

PDB Entry: 3ndr (more details), 2.88 Å

PDB Description: Crystal structure of tetrameric pyridoxal 4-dehydrogenase from Mesorhizobium loti
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d3ndra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndra_ c.2.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}
terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
dagmvrh

SCOPe Domain Coordinates for d3ndra_:

Click to download the PDB-style file with coordinates for d3ndra_.
(The format of our PDB-style files is described here.)

Timeline for d3ndra_: