Lineage for d1gota1 (1got A:61-181)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 917893Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 917894Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 917895Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 917896Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 917930Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)
  8. 917961Domain d1gota1: 1got A:61-181 [18213]
    Other proteins in same PDB: d1gota2, d1gotb_, d1gotg_
    species chimera
    complexed with gdp

Details for d1gota1

PDB Entry: 1got (more details), 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
PDB Compounds: (A:) gt-alpha/gi-alpha chimera

SCOPe Domain Sequences for d1gota1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gota1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

SCOPe Domain Coordinates for d1gota1:

Click to download the PDB-style file with coordinates for d1gota1.
(The format of our PDB-style files is described here.)

Timeline for d1gota1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gota2