Class a: All alpha proteins [46456] (290 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) |
Domain d1gota1: 1got A:61-181 [18213] Other proteins in same PDB: d1gota2, d1gotb_, d1gotg_ species chimera complexed with gdp |
PDB Entry: 1got (more details), 2 Å
SCOPe Domain Sequences for d1gota1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gota1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi i
Timeline for d1gota1: