Lineage for d3n9ka_ (3n9k A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569823Protein automated matches [190057] (20 species)
    not a true protein
  7. 1569920Species Yeast (Candida albicans) [TaxId:5476] [188406] (6 PDB entries)
  8. 1569921Domain d3n9ka_: 3n9k A: [182094]
    automated match to d1cz1a_
    complexed with ca; mutant

Details for d3n9ka_

PDB Entry: 3n9k (more details), 1.7 Å

PDB Description: f229a/e292s double mutant of exo-beta-1,3-glucanase from candida albicans in complex with laminaritriose at 1.7 a
PDB Compounds: (A:) Glucan 1,3-beta-glucosidase

SCOPe Domain Sequences for d3n9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n9ka_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdaaqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOPe Domain Coordinates for d3n9ka_:

Click to download the PDB-style file with coordinates for d3n9ka_.
(The format of our PDB-style files is described here.)

Timeline for d3n9ka_: