SCOPe 2.08: Domain d1tnda1: 1tnd A:57-177

Lineage for d1tnda1 (1tnd A:57-177)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)

8. Domain d1tnda1: 1tnd A:57-177 [18198]
   Other proteins in same PDB: d1tnda2, d1tndb2, d1tndc2
   complexed with cac, gsp, mg

Details for d1tnda1

PDB Entry: 1tnd, 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s

PDB Compounds: (A:) transducin

SCOPe Domain Sequences for d1tnda1:

Sequence; same for both SEQRES and ATOM records:

>d1tnda1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t

Timeline for d1tnda1:

• d1tnda1 first appeared (with stable ids) in SCOP 1.55
  
• d1tnda1 appears in SCOPe 2.07