Lineage for d3n7ta_ (3n7t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859422Species Fungus (Coccidioides immitis) [TaxId:5501] [189368] (1 PDB entry)
  8. 2859423Domain d3n7ta_: 3n7t A: [181978]
    automated match to d1qvvb_
    complexed with cl, edo, po4

Details for d3n7ta_

PDB Entry: 3n7t (more details), 2.1 Å

PDB Description: Crystal structure of a macrophage binding protein from Coccidioides immitis
PDB Compounds: (A:) Macrophage binding protein

SCOPe Domain Sequences for d3n7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n7ta_ c.23.16.0 (A:) automated matches {Fungus (Coccidioides immitis) [TaxId: 5501]}
plprkallaitsahppfwpdgkrtglffsealhpfneltaagfevdvasetgtfgwdehs
ltqeylskedekvlhsehnhfmekmnkqvfkagdlaphdyglmfvcgghgalydfphakh
lqniaqdiykrggvigavchgpamlpgihdengdsvikdktvtgfttkgeimikvidkmr
edhlhtiadmaqtanaeyvppedpwddfckvdgrivtganpqsatntardtikvyegivn
e

SCOPe Domain Coordinates for d3n7ta_:

Click to download the PDB-style file with coordinates for d3n7ta_.
(The format of our PDB-style files is described here.)

Timeline for d3n7ta_: