Lineage for d3n6na_ (3n6n A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017732Protein automated matches [190260] (25 species)
    not a true protein
  7. 3017971Species Human enterovirus 71 [TaxId:39054] [189988] (4 PDB entries)
  8. 3017975Domain d3n6na_: 3n6n A: [181942]
    automated match to d1ra6a_
    complexed with bup, ni

Details for d3n6na_

PDB Entry: 3n6n (more details), 2.9 Å

PDB Description: crystal structure of EV71 RdRp in complex with Br-UTP
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d3n6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n6na_ e.8.1.4 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
geiqwvkpnketgrlsingptrtklepsvfhdvfegnkepavlhskdprlevdfeqalfs
kyvgntlyepdeyikeaalhyanqlkqleintsqmsmeeacygtenleaidlhtsagypy
salgikkrdildpttrdvskmkfymdkygldlpystyvkdelrsidkikkgksrlieass
lndsvylrmafghlyetfhanpgtitgsavgcnpdtfwsklpillpgslfafdysgydas
lspvwfralelvlreigysegaislieginhthhvyrnktycvlggmpsgcsgtsifnsm
inniiiralliktfkgidldelnmvaygddvlasypfpidclelaktgkeygltmtpadk
spcfnevnwdnatflkrgflpdeqfpflihptmpmreihesirwtkdarntqdhvrslcl
lawhngkqeyekfvstirsvpvgralaipnyenlrrnwlelf

SCOPe Domain Coordinates for d3n6na_:

Click to download the PDB-style file with coordinates for d3n6na_.
(The format of our PDB-style files is described here.)

Timeline for d3n6na_: