Class a: All alpha proteins [46456] (289 folds) |
Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
Superfamily a.65.1: Annexin [47874] (2 families) duplication: consists of four domains of the same fold |
Family a.65.1.1: Annexin [47875] (10 proteins) |
Protein Plant annexin-like protein [47892] (2 species) |
Species Bell pepper (Capsicum annuum) [TaxId:4072] [47893] (1 PDB entry) |
Domain d1dk5b1: 1dk5 B:409-721 [18193] Other proteins in same PDB: d1dk5a2, d1dk5b2 complexed with so4 |
PDB Entry: 1dk5 (more details), 2.8 Å
SCOPe Domain Sequences for d1dk5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dk5b1 a.65.1.1 (B:409-721) Plant annexin-like protein {Bell pepper (Capsicum annuum) [TaxId: 4072]} masltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaetfged llkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspkelvl areayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilhekis dkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikglvyp ehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakdtrgd yesmllallgqee
Timeline for d1dk5b1: