Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546 |
Protein automated matches [191165] (3 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [189377] (2 PDB entries) |
Domain d3n4ja1: 3n4j A:1-160 [181893] Other proteins in same PDB: d3n4ja2 automated match to d1j85a_ complexed with so4 |
PDB Entry: 3n4j (more details), 1.47 Å
SCOPe Domain Sequences for d3n4ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n4ja1 c.116.1.1 (A:1-160) automated matches {Yersinia pestis [TaxId: 214092]} mlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadikhh hdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayildalp aqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgall
Timeline for d3n4ja1: