Lineage for d3n4ja1 (3n4j A:1-160)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528468Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 2528489Protein automated matches [191165] (3 species)
    not a true protein
  7. 2528495Species Yersinia pestis [TaxId:214092] [189377] (2 PDB entries)
  8. 2528496Domain d3n4ja1: 3n4j A:1-160 [181893]
    Other proteins in same PDB: d3n4ja2
    automated match to d1j85a_
    complexed with so4

Details for d3n4ja1

PDB Entry: 3n4j (more details), 1.47 Å

PDB Description: putative rna methyltransferase from yersinia pestis
PDB Compounds: (A:) RNA methyltransferase

SCOPe Domain Sequences for d3n4ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n4ja1 c.116.1.1 (A:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
mlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadikhh
hdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayildalp
aqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgall

SCOPe Domain Coordinates for d3n4ja1:

Click to download the PDB-style file with coordinates for d3n4ja1.
(The format of our PDB-style files is described here.)

Timeline for d3n4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n4ja2