SCOPe 2.04: Domain d3n4ia_: 3n4i A:

Lineage for d3n4ia_ (3n4i A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (23 PDB entries)
   inhibited by tazobactam
   Uniprot Q5PSW7 ! Uniprot P14557 22-286

8. Domain d3n4ia_: 3n4i A: [181891]
   Other proteins in same PDB: d3n4ib_
   automated match to d1onga_

Details for d3n4ia_

PDB Entry: 3n4i, 1.56 Å

PDB Description: crystal structure of the shv-1 d104e beta-lactamase/beta-lactamase inhibitor protein (blip) complex

PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d3n4ia_:

Sequence; same for both SEQRES and ATOM records:

>d3n4ia_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlveyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d3n4ia_:

• d3n4ia_ first appeared in SCOPe 2.01
  
• d3n4ia_ appears in SCOPe 2.03
  
• d3n4ia_ appears in SCOPe 2.05
  
• d3n4ia_ appears in the current release, SCOPe 2.08