SCOPe 2.08: Domain d3n2ya_: 3n2y A:

Lineage for d3n2ya_ (3n2y A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)

7. Species Methanococcus jannaschii [TaxId:2190] [89611] (9 PDB entries)

8. Domain d3n2ya_: 3n2y A: [181859]
   automated match to d1j1ua_
   protein/RNA complex; complexed with tef

Details for d3n2ya_

PDB Entry: 3n2y, 2.49 Å

PDB Description: crystal structure of tyrosyl-trna synthetase complexed with p-(2- tetrazolyl)-phenylalanine

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d3n2ya_:

Sequence; same for both SEQRES and ATOM records:

>d3n2ya_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagfd
iiiiladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefmldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvngihyvggdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

Timeline for d3n2ya_:

• d3n2ya_ first appeared in SCOPe 2.01
  
• d3n2ya_ appears in SCOPe 2.07