Lineage for d3n20c_ (3n20 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2180404Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2180405Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 2180406Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 2180407Species Pseudomonas sp. [TaxId:320855] [189499] (11 PDB entries)
  8. 2180408Domain d3n20c_: 3n20 C: [181832]
    Other proteins in same PDB: d3n20a_, d3n20b_
    automated match to d1t0rc_
    complexed with fe, gol, p6g; mutant

Details for d3n20c_

PDB Entry: 3n20 (more details), 1.9 Å

PDB Description: X-ray Crystal Structure of Toluene/o-Xylene Monooxygenase Hydroxylase T201V Mutant
PDB Compounds: (C:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3n20c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n20c_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOPe Domain Coordinates for d3n20c_:

Click to download the PDB-style file with coordinates for d3n20c_.
(The format of our PDB-style files is described here.)

Timeline for d3n20c_: