Lineage for d3n20b_ (3n20 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911971Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 911972Species Pseudomonas sp. [TaxId:320855] [189498] (10 PDB entries)
  8. 911973Domain d3n20b_: 3n20 B: [181831]
    Other proteins in same PDB: d3n20a_, d3n20c_
    automated match to d1t0rb_
    complexed with fe, gol, p6g; mutant

Details for d3n20b_

PDB Entry: 3n20 (more details), 1.9 Å

PDB Description: X-ray Crystal Structure of Toluene/o-Xylene Monooxygenase Hydroxylase T201V Mutant
PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3n20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n20b_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

SCOPe Domain Coordinates for d3n20b_:

Click to download the PDB-style file with coordinates for d3n20b_.
(The format of our PDB-style files is described here.)

Timeline for d3n20b_: