Lineage for d3n1na_ (3n1n A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000185Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 3000301Domain d3n1na_: 3n1n A: [181793]
    automated match to d1ahaa_
    complexed with gun

Details for d3n1na_

PDB Entry: 3n1n (more details), 2.23 Å

PDB Description: crystal structure of the complex of type i ribosome inactivating protein with guanine at 2.2a resolution
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3n1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1na_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d3n1na_:

Click to download the PDB-style file with coordinates for d3n1na_.
(The format of our PDB-style files is described here.)

Timeline for d3n1na_: