SCOPe 2.06: Domain d3n1fd1: 3n1f D:826-924

Lineage for d3n1fd1 (3n1f D:826-924)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)

8. Domain d3n1fd1: 3n1f D:826-924 [181782]
   Other proteins in same PDB: d3n1fa_, d3n1fb_, d3n1fd2
   automated match to d1x4ya1
   complexed with ca, zn

Details for d3n1fd1

PDB Entry: 3n1f, 1.6 Å

PDB Description: Crystal Structure of IhhN bound to CDOFn3

PDB Compounds: (D:) Cell adhesion molecule-related/down-regulated by oncogenes

SCOPe Domain Sequences for d3n1fd1:

Sequence; same for both SEQRES and ATOM records:

>d3n1fd1 b.1.2.1 (D:826-924) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pitgphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegs
kqwhmighlqpetsydikmqcfneggesefsnvmicetk

Timeline for d3n1fd1:

• d3n1fd1 first appeared in SCOPe 2.01, called d3n1fd_
  
• d3n1fd1 was called d3n1fd_ in SCOPe 2.05
  
• d3n1fd1 appears in SCOPe 2.07
  
• d3n1fd1 appears in the current release, SCOPe 2.08