Lineage for d3mzte_ (3mzt E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1758823Protein beta2-microglobulin [88600] (5 species)
  7. 1758835Species Human (Homo sapiens) [TaxId:9606] [88602] (388 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 1759357Domain d3mzte_: 3mzt E: [181737]
    automated match to d1a9bb_
    complexed with cu, tfx

Details for d3mzte_

PDB Entry: 3mzt (more details), 2.7 Å

PDB Description: protein-induced photophysical changes to the amyloid indicator dye, thioflavin t
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3mzte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzte_ b.1.1.2 (E:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

SCOPe Domain Coordinates for d3mzte_:

Click to download the PDB-style file with coordinates for d3mzte_.
(The format of our PDB-style files is described here.)

Timeline for d3mzte_: