Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein automated matches [190177] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries) |
Domain d3myyb_: 3myy B: [181719] automated match to d1a0oa_ complexed with bef, gol, mn, so4; mutant |
PDB Entry: 3myy (more details), 2.1 Å
SCOPe Domain Sequences for d3myyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3myyb_ c.23.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln kifeklgm
Timeline for d3myyb_: