SCOPe 2.06: Domain d3myma_: 3mym A:

Lineage for d3myma_ (3mym A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d3myma_: 3mym A: [181700]
   automated match to d1ew6a_
   complexed with cyn, hem, so4; mutant

Details for d3myma_

PDB Entry: 3mym, 1.72 Å

PDB Description: Mutation of Methionine-86 in Dehaloperoxidase-hemoglobin: Effects of the Asp-His-Fe Triad in a 3/3 Globin

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3myma_:

Sequence; same for both SEQRES and ATOM records:

>d3myma_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqekqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3myma_:

• d3myma_ first appeared in SCOPe 2.01
  
• d3myma_ appears in SCOPe 2.05
  
• d3myma_ appears in SCOPe 2.07
  
• d3myma_ appears in the current release, SCOPe 2.08