![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries) |
![]() | Domain d3mtnc_: 3mtn C: [181548] Other proteins in same PDB: d3mtnb1, d3mtnb2, d3mtnd1, d3mtnd2 automated match to d2ibia1 complexed with cl, gol, zn |
PDB Entry: 3mtn (more details), 2.7 Å
SCOPe Domain Sequences for d3mtnc_:
Sequence, based on SEQRES records: (download)
>d3mtnc_ d.3.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigal whpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrgrrappila ngpvpspprrggalleepelsdddranlmwkryleredskivdlfvgqlksclkcqacgy rsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenapvcdrcrqktrstkk ltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasdkagspvyqlyalcn hsgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfyqlm
>d3mtnc_ d.3.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigal whpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrsdddranlm wkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfgkvslrdcf nlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgv dfplqrlslgdfasspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenq vassegyvlfyqlm
Timeline for d3mtnc_: