Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (8 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (209 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d3mtnb1: 3mtn B:1-76 [181547] Other proteins in same PDB: d3mtna_, d3mtnb2, d3mtnc_, d3mtnd2 automated match to d1p3qu_ complexed with cl, gol, zn |
PDB Entry: 3mtn (more details), 2.7 Å
SCOPe Domain Sequences for d3mtnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mtnb1 d.15.1.1 (B:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkwstlflllrlrgg
Timeline for d3mtnb1:
View in 3D Domains from other chains: (mouse over for more information) d3mtna_, d3mtnc_, d3mtnd1, d3mtnd2 |