Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins) stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907 |
Protein Gar1 homolog PF1791 [141342] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries) Uniprot Q8U029 1-73 |
Domain d3mqkc_: 3mqk C: [181494] Other proteins in same PDB: d3mqkb_ automated match to d2hvyb1 protein/RNA complex |
PDB Entry: 3mqk (more details), 2.8 Å
SCOPe Domain Sequences for d3mqkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mqkc_ b.43.3.5 (C:) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]} mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs npeiyvgevlyvder
Timeline for d3mqkc_: