Lineage for d3mqkc_ (3mqk C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126973Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins)
    stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
  6. 1126974Protein Gar1 homolog PF1791 [141342] (1 species)
  7. 1126975Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries)
    Uniprot Q8U029 1-73
  8. 1126978Domain d3mqkc_: 3mqk C: [181494]
    Other proteins in same PDB: d3mqkb_
    automated match to d2hvyb1
    protein/RNA complex

Details for d3mqkc_

PDB Entry: 3mqk (more details), 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide
PDB Compounds: (C:) Small nucleolar rnp gar1-like protein

SCOPe Domain Sequences for d3mqkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mqkc_ b.43.3.5 (C:) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvder

SCOPe Domain Coordinates for d3mqkc_:

Click to download the PDB-style file with coordinates for d3mqkc_.
(The format of our PDB-style files is described here.)

Timeline for d3mqkc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mqkb_