Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Elastase [50536] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50538] (116 PDB entries) |
Domain d3moca_: 3moc A: [181464] automated match to d1b0ea_ complexed with na, so4 |
PDB Entry: 3moc (more details), 1.82 Å
SCOPe Domain Sequences for d3moca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3moca_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
Timeline for d3moca_: