Lineage for d3mm0b_ (3mm0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806127Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2806204Domain d3mm0b_: 3mm0 B: [181392]
    automated match to d1rava_

Details for d3mm0b_

PDB Entry: 3mm0 (more details), 2.7 Å

PDB Description: crystal structure of chimeric avidin
PDB Compounds: (B:) Avidin, Avidin-related protein 4/5

SCOPe Domain Sequences for d3mm0b_:

Sequence, based on SEQRES records: (download)

>d3mm0b_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptfg
ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftrl

Sequence, based on observed residues (ATOM records): (download)

>d3mm0b_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptfg
ftvnwkfsesttvftgqcfigkevlktmwllrssvndigddwkatrvgyniftrl

SCOPe Domain Coordinates for d3mm0b_:

Click to download the PDB-style file with coordinates for d3mm0b_.
(The format of our PDB-style files is described here.)

Timeline for d3mm0b_: