SCOPe 2.08: Domain d3mlba_: 3mlb A:

Lineage for d3mlba_ (3mlb A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (6 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries)

8. Domain d3mlba_: 3mlb A: [181378]
   automated match to d1kama_
   complexed with fmt, k, ljz

Details for d3mlba_

PDB Entry: 3mlb, 1.8 Å

PDB Description: BaNadD in complex with inhibitor 1_02_1

PDB Compounds: (A:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d3mlba_:

Sequence; same for both SEQRES and ATOM records:

>d3mlba_ c.26.1.3 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

Timeline for d3mlba_:

• d3mlba_ first appeared in SCOPe 2.01
  
• d3mlba_ appears in SCOPe 2.07