SCOPe 2.06: Domain d3ml5a_: 3ml5 A:

Lineage for d3ml5a_ (3ml5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (29 PDB entries)

8. Domain d3ml5a_: 3ml5 A: [181375]
   automated match to d1ugda_
   complexed with azm, zn; mutant

Details for d3ml5a_

PDB Entry: 3ml5, 2.05 Å

PDB Description: Crystal structure of the C183S/C217S mutant of human CA VII in complex with acetazolamide

PDB Compounds: (A:) Carbonic anhydrase 7

SCOPe Domain Sequences for d3ml5a_:

Sequence; same for both SEQRES and ATOM records:

>d3ml5a_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghhgwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyeacmslsit
nnghsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgksfpselhl
vhwnakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtkaqfscfn
pksllpasrhywtypgslttpplsesvtwivlrepisiserqmgkfrsllftsedderih
mvnnfrppqplkgrvvkasfra

Timeline for d3ml5a_:

• d3ml5a_ first appeared in SCOPe 2.01
  
• d3ml5a_ appears in SCOPe 2.05
  
• d3ml5a_ appears in SCOPe 2.07
  
• d3ml5a_ appears in the current release, SCOPe 2.08