SCOPe 2.01: Domain d3mkbd_: 3mkb D:

Lineage for d3mkbd_ (3mkb D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (30 species)
   not a true protein

7. Species Isurus oxyrinchus [TaxId:57983] [189618] (1 PDB entry)

8. Domain d3mkbd_: 3mkb D: [181342]
   automated match to d1gcvb_
   complexed with hem

Details for d3mkbd_

PDB Entry: 3mkb, 1.9 Å

PDB Description: crystal structure determination of shortfin mako (isurus oxyrinchus) hemoglobin at 1.9 angstrom resolution

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3mkbd_:

Sequence, based on SEQRES records:

>d3mkbd_ a.1.1.2 (D:) automated matches {Isurus oxyrinchus [TaxId: 57983]}
vhwtqeerdeivktffsanssaigtkalermfvvfpwtnayfakxxxfsasihaaivvga
lqdavkheddvkaefvniskahadklhidpgsfhlltdsfivelahlkkvaftpfvfavw
ikffqvvidaissqyh

Sequence, based on observed residues (ATOM records):

>d3mkbd_ a.1.1.2 (D:) automated matches {Isurus oxyrinchus [TaxId: 57983]}
vhwtqeerdeivktffsanssaigtkalermfvvfpwtnayffsasihaaivvgalqdav
kheddvkaefvniskahadklhidpgsfhlltdsfivelahlkkvaftpfvfavwikffq
vvidaissqyh

Timeline for d3mkbd_:

• d3mkbd_ is new in SCOPe 2.01-stable
  
• d3mkbd_ appears in SCOPe 2.02
  
• d3mkbd_ appears in the current release, SCOPe 2.08