Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (30 species) not a true protein |
Species Isurus oxyrinchus [TaxId:57983] [189618] (1 PDB entry) |
Domain d3mkba_: 3mkb A: [181340] automated match to d1gcva_ complexed with hem |
PDB Entry: 3mkb (more details), 1.9 Å
SCOPe Domain Sequences for d3mkba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mkba_ a.1.1.2 (A:) automated matches {Isurus oxyrinchus [TaxId: 57983]} aftgverstigaiakilastpeaygaealarlfathpgaksyfdyadysaagakvqlhgg kviravvsaaehdddlhahlmvlavthgkkllvdpsnfpmlsecilvtlathlaefspat hcavdkllsaisselsskyr
Timeline for d3mkba_: