Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
Protein automated matches [190903] (22 species) not a true protein |
Species Coryneform bacterium [TaxId:1728] [189898] (4 PDB entries) |
Domain d3mjzi_: 3mjz I: [181317] automated match to d2aaga1 |
PDB Entry: 3mjz (more details), 2.4 Å
SCOPe Domain Sequences for d3mjzi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjzi_ d.80.1.0 (I:) automated matches {Coryneform bacterium [TaxId: 1728]} pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs aqyvtgelaip
Timeline for d3mjzi_: