Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab5a [82399] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries) Uniprot P20339 18-182 |
Domain d3mjhc_: 3mjh C: [181299] automated match to d1tu4a_ complexed with gtp, mg, zn |
PDB Entry: 3mjh (more details), 2.03 Å
SCOPe Domain Sequences for d3mjhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjhc_ c.37.1.8 (C:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} kicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdt agleryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkad lankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk
Timeline for d3mjhc_: