SCOPe 2.04: Domain d3miyb_: 3miy B:

Lineage for d3miyb_ (3miy B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (28 PDB entries)
   Uniprot Q08881 357-619

8. Domain d3miyb_: 3miy B: [181294]
   automated match to d1sm2a_
   complexed with b49

Details for d3miyb_

PDB Entry: 3miy, 1.67 Å

PDB Description: x-ray crystal structure of itk complexed with sunitinib

PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3miyb_:

Sequence, based on SEQRES records:

>d3miyb_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
easvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaaiaasg

Sequence, based on observed residues (ATOM records):

>d3miyb_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgglvhlgywlnkdkvaiktiseedfieeaevmmklshpklvql
ygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeasvihr
dlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipy
enrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaaiaasg

Timeline for d3miyb_:

• d3miyb_ first appeared in SCOPe 2.01
  
• d3miyb_ appears in SCOPe 2.03
  
• d3miyb_ appears in SCOPe 2.05
  
• d3miyb_ appears in the current release, SCOPe 2.08, called d3miyb1