SCOPe 2.08: Domain d3mi0w_: 3mi0 W:

Lineage for d3mi0w_ (3mi0 W:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187707] (16 PDB entries)

8. Domain d3mi0w_: 3mi0 W: [181261]
   Other proteins in same PDB: d3mi0r2, d3mi0v2
   automated match to d1q5qa_
   complexed with dmf, sa6

Details for d3mi0w_

PDB Entry: 3mi0, 2.2 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome at 2.2 A

PDB Compounds: (W:) Proteasome subunit alpha

SCOPe Domain Sequences for d3mi0w_:

Sequence, based on SEQRES records:

>d3mi0w_ d.153.1.4 (W:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
fispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaa
gkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcva
evahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriav
aalragsadtsggdqptlgvaslevavldanrprrafrritgsalqall

Sequence, based on observed residues (ATOM records):

>d3mi0w_ d.153.1.4 (W:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
fispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaa
gkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcva
evahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriav
aalragvaslevavldanrprrafrritgsalqall

Timeline for d3mi0w_:

• d3mi0w_ first appeared in SCOPe 2.01
  
• d3mi0w_ appears in SCOPe 2.07